PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010098301.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NF-YB
Protein Properties Length: 169aa    MW: 19507.7 Da    PI: 6.7205
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010098301.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB159.84.1e-5026121297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     re++r+lPianv+rimk++lP n kisk++ket+qecvsefisf+t+ea+dkc++e+rkt+ngdd++wal  lGf+dy+ pl+ yl+kyre+eg+
  XP_010098301.1  26 REHERLLPIANVGRIMKHILPPNVKISKQSKETMQECVSEFISFITGEATDKCRKERRKTVNGDDVCWALQALGFDDYAGPLRRYLHKYREMEGD 120
                     899*******************************************************************************************9 PP

           NF-YB  97 k 97 
                     +
  XP_010098301.1 121 R 121
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-4922140IPR009072Histone-fold
SuperFamilySSF471131.18E-3729141IPR009072Histone-fold
PfamPF008081.7E-243195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.0E-165977No hitNo description
PRINTSPR006152.0E-167896No hitNo description
PRINTSPR006152.0E-1697115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MDNNLSINGP SGASNINREV DHEIIREHER LLPIANVGRI MKHILPPNVK ISKQSKETMQ  60
ECVSEFISFI TGEATDKCRK ERRKTVNGDD VCWALQALGF DDYAGPLRRY LHKYREMEGD  120
RANQEKAKST NGHHELGNND LRLNNNHDHD LREYLVDGRR RSEDDSDRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4025116192Transcription factor HapC (Eurofung)
4g92_B2e-4025116192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010098301.11e-124Nuclear transcription factor Y subunit B-5
SwissprotO822483e-54NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLW9RVI61e-124W9RVI6_9R
STRINGPOPTR_0008s22520.15e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-55nuclear factor Y, subunit B5